PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3937_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 259aa    MW: 29259.2 Da    PI: 8.295
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3937_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof96.22.4e-302075560
      zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                 + cprC+stntkfCyynny +sqPry Ck C r+Wt+GG lrn+P Gg+ r+ ++
  RrC3937_p1 20 PRVCPRCNSTNTKFCYYNNYRVSQPRYKCKDCLRHWTHGGELRNIPTGGSGRNINH 75
                678***********************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-181571IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.0992175IPR003851Zinc finger, Dof-type
PfamPF027012.7E-282174IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDYSSVFARD NGVNQEKPPP RVCPRCNSTN TKFCYYNNYR VSQPRYKCKD CLRHWTHGGE  60
LRNIPTGGSG RNINHTRIDQ PLVSQAVSAG IQQVSPRHQP FLHGQETNKF VGSFGDSSSG  120
IAFGNQIGSF PEIHSDVVLP LPPMDHSYFH DGLFQQDYYN IESNALIGNY LNNQSIGNHL  180
INQSIGSYNL MSSHHNSYIN QEDQNKWNQR FNNTMNLNHN ASTSGSRVSL ESDHMNKNNG  240
NIKNNCVCKS SYHLEKHGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013654838.11e-138PREDICTED: dof zinc finger protein DOF4.3-like
SwissprotQ9SUA92e-49DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078CMV41e-138A0A078CMV4_BRANA; BnaA08g09920D protein
STRINGBra020881.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.18e-51Dof-type zinc finger domain-containing protein